PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00951.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 443aa    MW: 49809.6 Da    PI: 5.3853
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00951.1_g00018.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.91.7e-52271541128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              l+pGfrFhPtdeelv++yLk+kv gk++++ ++i evdiyk+ePwdL   +++k++++ewyf+s  dkky +g r nrat++gyWk
  Rsa1.0_00951.1_g00018.1  27 LAPGFRFHPTDEELVSYYLKRKVLGKPVRF-DAIGEVDIYKHEPWDLAvfSRLKTRDQEWYFYSALDKKYGNGARMNRATNKGYWK 111
                              579************************999.99**************8544899999***************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd+e+ + + +  g+kktLvf++grap+g +t+Wvmheyrl
  Rsa1.0_00951.1_g00018.1 112 ATGKDREIRR-DVQILGMKKTLVFHSGRAPDGLRTNWVMHEYRL 154
                              *********9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-6021179IPR003441NAC domain
PROSITE profilePS5100557.3727178IPR003441NAC domain
PfamPF023656.5E-2729154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MGRESMAVES SPPSATAPAT AVSATALAPG FRFHPTDEEL VSYYLKRKVL GKPVRFDAIG  60
EVDIYKHEPW DLAVFSRLKT RDQEWYFYSA LDKKYGNGAR MNRATNKGYW KATGKDREIR  120
RDVQILGMKK TLVFHSGRAP DGLRTNWVMH EYRLVDYETE SNGNLVQDAY VLCRIFHKNN  180
IGPPSGNRYA PFMEEEWSDD GVALIPGVDV SVRAEPIPLA NGNSQESKDL ININEPPRET  240
TQMDIELNHQ NHQENNNNNN RHDEEAEEAL KREQAEEDDH PPPPPPPADV CVLNKEAPLP  300
LLQYKRRRQN ESTRTTTQDH CSSTTTTVDN TPTTLISSST AAAATNTAIS ALLEFSLMGI  360
SDKKENPPQP PRKEASPPPP APLPSPEEKL NDLQKEVHQM SVERETFKLE MMSAEAMISI  420
LQSRIDALRQ ENDELKKCSA NGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-47161809167NO APICAL MERISTEM PROTEIN
1ut4_B3e-47161809167NO APICAL MERISTEM PROTEIN
1ut7_A3e-47161809167NO APICAL MERISTEM PROTEIN
1ut7_B3e-47161809167NO APICAL MERISTEM PROTEIN
3swm_A3e-471618012170NAC domain-containing protein 19
3swm_B3e-471618012170NAC domain-containing protein 19
3swm_C3e-471618012170NAC domain-containing protein 19
3swm_D3e-471618012170NAC domain-containing protein 19
3swp_A3e-471618012170NAC domain-containing protein 19
3swp_B3e-471618012170NAC domain-containing protein 19
3swp_C3e-471618012170NAC domain-containing protein 19
3swp_D3e-471618012170NAC domain-containing protein 19
4dul_A3e-47161809167NAC domain-containing protein 19
4dul_B3e-47161809167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667530.0KC966753.1 Brassica napus NAC transcription factor 51 (NAC51.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013750306.10.0PREDICTED: NAC domain-containing protein 78-like isoform X3
TrEMBLA0A078F5F00.0A0A078F5F0_BRANA; BnaA05g28370D protein
STRINGBra029844.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17802880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.20.0NAC domain containing protein 52